DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and mettl27

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_021324579.1 Gene:mettl27 / 678636 ZFINID:ZDB-GENE-060421-5918 Length:235 Species:Danio rerio


Alignment Length:187 Identity:38/187 - (20%)
Similarity:74/187 - (39%) Gaps:35/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLSGSVLEDSE 73
            |..::.:.|..|..|..:..:::.:..:...........||.|...:||:.||:||.      |:
Zfish    31 AQDKVGFYDTWADNYEQDVAVLDYRAPLLAAECVSSFFNDDREKATVLDVACGTGLV------SK 89

  Fly    74 HM-------WIGIDISKSMLDIAVEREVAGDVILGDMGEG-MPFKPGTFD-----GAISISALQW 125
            |:       :.|:|.|..||:.|.:..:...::...:|:. :|.|..|:|     ||:|:..:  
Zfish    90 HLKRMGFRHFDGVDGSLRMLEGAKKTGLYKQLMHCMLGQDRIPVKAETYDVVIIVGALSVGQV-- 152

  Fly   126 LCNADKSYHNPHKRLLKFFTTL----FSCLTRTARAVFQFYPENSDQIEMVTSQAMK 178
                      |.|.:.:.:...    :.|:|..|....|.|....:|:.....:..|
Zfish   153 ----------PLKVIRELWDATKPGGYVCMTTRANTDNQKYKAELEQMIKALEEEQK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 24/98 (24%)
WBS_methylT 202..272 CDD:289366
mettl27XP_021324579.1 Methyltransf_25 77..168 CDD:316196 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.