DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and Bud23

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_030110611.1 Gene:Bud23 / 66138 MGIID:1913388 Length:300 Species:Mus musculus


Alignment Length:278 Identity:159/278 - (57%)
Similarity:211/278 - (75%) Gaps:4/278 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARRPEHSAPPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLSG 66
            :||||||.|||:||:.:||:||..|:|:|:||.:|.|||||||.||:...|.| |||||||||||
Mouse    24 SRRPEHSGPPELFYDQNEARKYVRNSRMIDIQTKMTERALELLCLPEGQPSYL-LDIGCGSGLSG 87

  Fly    67 SVLEDSEHMWIGIDISKSMLDIAVEREVAGDVILGDMGEGMPFKPGTFDGAISISALQWLCNADK 131
            ..:.:..|.|:|||||.:|||.|::|:..||::|||||:|:||:||:|||.|||||:||||||:|
Mouse    88 DYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQGVPFRPGSFDGCISISAVQWLCNANK 152

  Fly   132 SYHNPHKRLLKFFTTLFSCLTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAK 196
            ....|.:||..||::|:|.|.|.||||.|.|||||:|:|::|:||.:|||.||:|||:|||||||
Mouse   153 KSDVPARRLYCFFSSLYSALVRGARAVLQLYPENSEQLELITTQATRAGFTGGVVVDFPNSAKAK 217

  Fly   197 KYYLVLMTGGSAELPQALGSPEEERRVN---YIKKRDACREARGKAPKKSRDWILAKKERRRRQG 258
            |:||.|.:|.|..||:.|...::..:.:   :..:|...::||....||||:|:|.|||||||||
Mouse   218 KFYLCLFSGPSTSLPKGLTESQDADQASESMFTSERAPHKKARRDLVKKSREWVLEKKERRRRQG 282

  Fly   259 LETRPDTKYTARKRSGKF 276
            .|.||||:||.|||..:|
Mouse   283 KEVRPDTQYTGRKRKPRF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 53/85 (62%)
WBS_methylT 202..272 CDD:289366 32/72 (44%)
Bud23XP_030110611.1 UbiG 37..>110 CDD:225137 43/73 (59%)
Methyltransf_11 77..>147 CDD:369777 44/69 (64%)
WBS_methylT 223..298 CDD:372208 34/74 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845418
Domainoid 1 1.000 115 1.000 Domainoid score I6038
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5486
Inparanoid 1 1.050 330 1.000 Inparanoid score I2428
Isobase 1 0.950 - 0 Normalized mean entropy S550
OMA 1 1.010 - - QHG53740
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004742
OrthoInspector 1 1.000 - - oto94591
orthoMCL 1 0.900 - - OOG6_102190
Panther 1 1.100 - - LDO PTHR12734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3338
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.710

Return to query results.
Submit another query.