DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and C27F2.4

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_498051.1 Gene:C27F2.4 / 175671 WormBaseID:WBGene00016166 Length:283 Species:Caenorhabditis elegans


Alignment Length:278 Identity:151/278 - (54%)
Similarity:203/278 - (73%) Gaps:6/278 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RPEHSAPPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLSGSV 68
            :|||:.||:::||:.||.||::|:.|..||.||||||||||||| :.:|..:||||||:|:|..|
 Worm     7 KPEHTGPPDLYYNETEAAKYASNSHITAIQHEMAERALELLALP-EGKSGFLLDIGCGTGMSSEV 70

  Fly    69 LEDSEHMWIGIDISKSMLDIAVERE--VAGDVILGDMGEGMPFKPGTFDGAISISALQWLCNADK 131
            :.|:.||::|:|:|:.||:||.:.|  .:||.|..|||.||||:||:|||||||||:||||:|:.
 Worm    71 ILDAGHMFVGVDVSRPMLEIARQDEDLESGDFIHQDMGLGMPFRPGSFDGAISISAIQWLCHANA 135

  Fly   132 SYHNPHKRLLKFFTTLFSCLTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAK 196
            |..||.||||.||.:|:.||.|.:||||||||||.:|.:::..||.||||.||||||:|.:||.|
 Worm   136 SDENPRKRLLFFFQSLYGCLGRGSRAVFQFYPENDEQCDLIMGQAHKAGFNGGLVVDFPEAAKRK 200

  Fly   197 KYYLVLMTGGSAELPQALGSPEEERR--VNYIKKRDACREARG-KAPKKSRDWILAKKERRRRQG 258
            |.||||||||..:|||||....||.|  ::...:|......:. |..|.|:.||.||::|:.:||
 Worm   201 KVYLVLMTGGVVQLPQALTEDGEESRTQIDNAGRRFVWNSRKNEKVAKGSKAWIEAKRQRQIKQG 265

  Fly   259 LETRPDTKYTARKRSGKF 276
            .:.|.::||:.|||..||
 Worm   266 RDVRHESKYSGRKRKTKF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 52/87 (60%)
WBS_methylT 202..272 CDD:289366 28/72 (39%)
C27F2.4NP_498051.1 SmtA 23..253 CDD:223574 128/230 (56%)
Methyltransf_11 58..163 CDD:285453 61/104 (59%)
WBS_methylT 206..281 CDD:289366 30/74 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163599
Domainoid 1 1.000 99 1.000 Domainoid score I4481
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5486
Inparanoid 1 1.050 295 1.000 Inparanoid score I1671
Isobase 1 0.950 - 0 Normalized mean entropy S550
OMA 1 1.010 - - QHG53740
OrthoDB 1 1.010 - - D1138059at2759
OrthoFinder 1 1.000 - - FOG0004742
OrthoInspector 1 1.000 - - oto17644
orthoMCL 1 0.900 - - OOG6_102190
Panther 1 1.100 - - LDO PTHR12734
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1706
SonicParanoid 1 1.000 - - X3338
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.