DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10903 and METTL27

DIOPT Version :9

Sequence 1:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_016867266.1 Gene:METTL27 / 155368 HGNCID:19068 Length:271 Species:Homo sapiens


Alignment Length:283 Identity:72/283 - (25%)
Similarity:107/283 - (37%) Gaps:76/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RPEHSAP---PEIFYNDDEAKKYSTNTRIIEIQVEMAERALELL--ALPDDDESRLILDIGCGSG 63
            |..|..|   .::.:.|..|..|..:  :..:.......|::.|  |||....|.||||:.||:|
Human    17 RAAHGIPDLAQKLHFYDRWAPDYDQD--VATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTG 79

  Fly    64 LSGSVLEDSEHMWI-GIDISKSMLDIAVEREVAGDVILGDMG-EGMPFKPGTFDGAISISAL--- 123
            |..:.|.....:.: |:|.|..||:.|....:...:.|..:| |.:|...||||..:.:.||   
Human    80 LVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDG 144

  Fly   124 QWLCNADKSYHNPHKRLLKFFTTLFS------------------------CL-TRTARAVFQFYP 163
            |..|||....|     :.|..||:.|                        || |||..:..|:  
Human   145 QVPCNAIPELH-----VTKPGTTIPSRDGPGLWLLPLPHLTYPSPPGGLVCLTTRTNSSNLQY-- 202

  Fly   164 ENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAKKYYLVLMTGGS----------AELPQALGSPE 218
              .:.:|....:..:||.:.|||. :|...        |.|.||          |.||:...|| 
Human   203 --KEALEATLDRLEQAGMWEGLVA-WPVDR--------LWTAGSWLPPSWRWYPASLPRMASSP- 255

  Fly   219 EERRVNYIKKRDACREARGKAPK 241
                     ....|.|: |:.|:
Human   256 ---------ALSTCTES-GRRPR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 28/90 (31%)
WBS_methylT 202..272 CDD:289366 13/50 (26%)
METTL27XP_016867266.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.