DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB60

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_172358.1 Gene:MYB60 / 837403 AraportID:AT1G08810 Length:280 Species:Arabidopsis thaliana


Alignment Length:141 Identity:39/141 - (27%)
Similarity:63/141 - (44%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DWNQISTLDLEYRHSPYSCEAMWRVYLTPDLRRDDWSPEEDETL--LAVATANRMQNWELIAASL 259
            :|..:.|.....|.|. ||...|..||.|.::|.:::|.|:..:  |.....|:   |..||:.|
plant    36 NWRSVPTNTGLLRCSK-SCRLRWTNYLRPGIKRGNFTPHEEGMIIHLQALLGNK---WASIASYL 96

  Fly   260 DRRSDYQCFVRFHTALRFLLEPKNSHRWSEEDNDKLRAIVDRNT-------ANSVINWKKVVEYF 317
            .:|:|......::|.|:..|...:|...|..:|..|:....|||       |:|..|..:::|.:
plant    97 PQRTDNDIKNYWNTHLKKKLNKSDSDERS
RSENIALQTSSTRNTINHRSTYASSTENISRLLEGW 161

  Fly   318 ----PDKSKST 324
                |..|.||
plant   162 MRASPKSSTST 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 13/42 (31%)
SANT 229..276 CDD:197842 12/48 (25%)
Myb_DNA-bind_6 287..350 CDD:372817 14/49 (29%)
SANT 392..438 CDD:197842
MYB60NP_172358.1 PLN03212 5..>125 CDD:178751 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.