DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB13

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_172108.1 Gene:MYB13 / 837127 AraportID:AT1G06180 Length:246 Species:Arabidopsis thaliana


Alignment Length:148 Identity:41/148 - (27%)
Similarity:71/148 - (47%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SCEAMWRVYLTPDLRRDDWSPEEDETLLAV--ATANRMQNWELIAASLDRRSDYQCFVRFHTALR 276
            ||...|..||.||::|.:::|.|::|::::  ...||   |..|||.|..|:|.:....:||.|:
plant    52 SCRLRWINYLRPDIKRGNFTPHEEDTIISLHQLLGNR---WSAIAAKLPGRTDNEIKNVWHTHLK 113

  Fly   277 FLLEPKNSHRWSEEDNDKLRAIVDRNTANSVINWKKVVEYFPDKSKSTLIGRYYYVLHPSISH-- 339
                 |..|. |::.|:| ...|....|....:.::......|.|..|.:|.     :..||:  
plant   114 -----KRLHH-SQDQNNK-EDFVSTTAAEMPTSPQQQSSSSADISAITTLGN-----NNDISNSN 166

  Fly   340 -EPFTTKEDMMLFAAVEE 356
             :..|:.||::  |.::|
plant   167 KDSATSSEDVL--AIIDE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 10/25 (40%)
SANT 229..276 CDD:197842 15/48 (31%)
Myb_DNA-bind_6 287..350 CDD:372817 14/65 (22%)
SANT 392..438 CDD:197842
MYB13NP_172108.1 PLN03091 1..>116 CDD:215570 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.