DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB99

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_201038.1 Gene:MYB99 / 836353 AraportID:AT5G62320 Length:245 Species:Arabidopsis thaliana


Alignment Length:95 Identity:29/95 - (30%)
Similarity:43/95 - (45%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 WNQISTLDLEYRHSPYSCEAMWRVYLTPDLRRDDWSPEEDETLLAVATANRMQN-WELIAASLDR 261
            |..:..| ...|....||...|..||.|||:|..::  |:|..|.:....|:.| |..||..|..
plant    45 WRDVPKL-AGLRRCGKSCRLRWTNYLRPDLKRGLFT--EEEIQLVIDLHARLGNRWSKIAVELPG 106

  Fly   262 RSDYQCFVRFHT-----ALRFLLEPKNSHR 286
            |:|......::|     .:|..::| |:||
plant   107 RTDNDIKNYWNTHIKRKLIRMGIDP-NTHR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 14/41 (34%)
SANT 229..276 CDD:197842 13/52 (25%)
Myb_DNA-bind_6 287..350 CDD:372817 29/95 (31%)
SANT 392..438 CDD:197842
MYB99NP_201038.1 PLN03091 3..>180 CDD:215570 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.