DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB59

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_200786.1 Gene:MYB59 / 836099 AraportID:AT5G59780 Length:235 Species:Arabidopsis thaliana


Alignment Length:65 Identity:21/65 - (32%)
Similarity:31/65 - (47%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SCEAMWRVYLTPDLRRDDWSPEEDETLLAVAT--ANRMQNWELIAASLDRRSDYQCFVRFHTALR 276
            ||...|..||.|.|:|...:|:|:..:|.:..  .||   |..||..|..|:|.:....:.|.:|
plant    48 SCRLRWVNYLHPGLKRGKMTPQEERLVLELHAKWGNR---WSKIARKLPGRTDNEIKNYWRTHMR 109

  Fly   277  276
            plant   110  109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 10/25 (40%)
SANT 229..276 CDD:197842 13/48 (27%)
Myb_DNA-bind_6 287..350 CDD:372817
SANT 392..438 CDD:197842
MYB59NP_200786.1 PLN03091 5..>115 CDD:215570 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.