DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB4R1

DIOPT Version :9

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_566597.1 Gene:MYB4R1 / 821335 AraportID:AT3G18100 Length:847 Species:Arabidopsis thaliana


Alignment Length:409 Identity:99/409 - (24%)
Similarity:171/409 - (41%) Gaps:41/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PNNEDYEARCHTEMFPTDFDMHSRHVWTLLDKKNVIMGIKQQ----LLEHRAHSTNALPSGSLKR 173
            |..|:|  |...|.:|...   .|..|:..:.||:..|:||:    ||......::.|...:...
plant   330 PCVENY--RMALEKYPISV---KRRKWSTEENKNLAKGLKQEVQKILLSEAIERSSDLEGATYDI 389

  Fly   174 KPIERHLSTLVSLLATADSSF--SIDWNQISTLDLEYRHSPYSCEAMWRVYLTPDLRRDDWSPEE 236
            ..|...:..| .:.......|  .|:|:   :||::.| |...|||.|.....|.:....|:..|
plant   390 DTINESIGNL-EITPEMIRQFLPKINWD---SLDIKDR-SAAECEARWMSSEDPLINHGPWTAAE 449

  Fly   237 DETLLAVATANRMQNWELIAASL-DRRSDYQCFVRFHTALRFLLEPKNSHRWSEEDNDKLRAIVD 300
            |:.||.......:.:|..||.|| ..|:.:||..|:..:|...:..|   .|:.|::|:||..|:
plant   450 DKNLLRTIEQTSLTDWVDIAVSLGTNRTPFQCLARYQRSLNPSILKK---EWTAEEDDQLRTAVE 511

  Fly   301 RNTANSVINWKKVVEYFPDKSKSTLIGRYYYVLHPSISHEPFTTKEDMMLFAAVEEYNGK-FHCF 364
            .....   :|:.|......::.:....|:...|.|: ....::.:||..:..||..:..: :|..
plant   512 LFGEK---DWQSVANVLKGRTGTQCSNRWKKSLRPT-RKGTWSLEEDKRVKVAVTLFGSQNWHKI 572

  Fly   365 PRSLFPNRSLTQLRTRYHNVLAQRNKTDSWSVQDDTRLMSFVTQYGASQWLNCATFLGNHTRTSC 429
            .: ..|.|:.||.|.|:.|.|..:.....|:.::|.:|...:.::|.| |...||.|...|...|
plant   573 SQ-FVPGRTQTQCRERWLNCLDPKVNRGKWTEEEDEKLREAIAEHGYS-WSKVATNLSCRTDNQC 635

  Fly   430 RTRF--------LVIKKFLEQNPNAKVEDLPRRRSKKVSLVNSDNWAQRLQEWQEDPESLVNDNP 486
            ..|:        .::::.......|.|.:...|.|::.:||.|...|......:.:|:|:..   
plant   636 LRRWKRLYPHQVALLQEARRLQKEASVGNFVDRESERPALVTSPILALPDISLEPEPDSVAL--- 697

  Fly   487 PKGTRVRGPKSKKARIERQ 505
               .:.|..|.||:..|||
plant   698 ---KKKRKAKQKKSDAERQ 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392 15/47 (32%)
SANT 229..276 CDD:197842 14/47 (30%)
Myb_DNA-binding 229..275 CDD:278669 14/46 (30%)
Myb_DNA-bind_6 287..350 CDD:290632 13/62 (21%)
SANT 392..438 CDD:197842 12/53 (23%)
Myb_DNA-binding 393..437 CDD:278669 12/51 (24%)
MYB4R1NP_566597.1 SANT 443..491 CDD:197842 15/47 (32%)
Myb_DNA-bind_6 445..506 CDD:290632 19/63 (30%)
SANT 495..543 CDD:197842 11/53 (21%)
SANT 497..541 CDD:238096 9/46 (20%)
SANT 546..594 CDD:197842 13/48 (27%)
Myb_DNA-bind_6 549..609 CDD:290632 15/60 (25%)
Myb_DNA-binding 598..642 CDD:278669 12/44 (27%)
SANT 598..642 CDD:197842 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006126
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.