DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB67

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_566434.1 Gene:MYB67 / 820454 AraportID:AT3G12720 Length:307 Species:Arabidopsis thaliana


Alignment Length:136 Identity:36/136 - (26%)
Similarity:58/136 - (42%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SCEAMWRVYLTPDLRRDDWSPEEDETLLAVATANRM--QNWELIAASLDRRSDYQCFVRFHTALR 276
            ||...|..||.|||||..::.||::.::.|   :|:  ..|..||..|..|:|.:....:::.::
plant    62 SCRLRWINYLRPDLRRGSFNEEEEQIIIDV---HRILGNKWAQIAKHLPGRTDNEVKNFWNSCIK 123

  Fly   277 FL-----LEPKN-----SHRWSEEDN-------DKLRAIV-------DRNTANSVINWKKVVEYF 317
            ..     |:|..     ||:.|...|       :|..:|:       ...||.|:.|........
plant   124 KKLLSQGLDPSTHNLMPSHKRSSSSNNNNIPKPNKTTSIMKNPTDLDQSTTAFSITNINPPTSTK 188

  Fly   318 PDKSKS 323
            |:|.||
plant   189 PNKLKS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 12/25 (48%)
SANT 229..276 CDD:197842 11/48 (23%)
Myb_DNA-bind_6 287..350 CDD:372817 12/51 (24%)
SANT 392..438 CDD:197842
MYB67NP_566434.1 PLN03091 12..>220 CDD:215570 36/136 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.