DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB83

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_187463.1 Gene:MYB83 / 819997 AraportID:AT3G08500 Length:343 Species:Arabidopsis thaliana


Alignment Length:95 Identity:28/95 - (29%)
Similarity:44/95 - (46%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SCEAMWRVYLTPDLRRDDWSPEEDETL--LAVATANRMQNWELIAASLDRRSDYQCFVRFHTALR 276
            ||...|..||.|||:|..:||:|::.:  |.....||   |..||..|..|:|.:....:::.|:
plant    70 SCRLRWINYLRPDLKRGSFSPQEEDLIFHLHSILGNR---WSQIATRLPGRTDNEIKNFWNSTLK 131

  Fly   277 FLLE------------PKNSHRWSEEDNDK 294
            ..|:            |.||:..|.:..|:
plant   132 KRLKNNSNNNTSSGSSPNNSNSNSLDPRDQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 12/25 (48%)
SANT 229..276 CDD:197842 13/48 (27%)
Myb_DNA-bind_6 287..350 CDD:372817 2/8 (25%)
SANT 392..438 CDD:197842
MYB83NP_187463.1 PLN03091 27..>135 CDD:215570 22/67 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.