DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and AS1

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_181299.1 Gene:AS1 / 818340 AraportID:AT2G37630 Length:367 Species:Arabidopsis thaliana


Alignment Length:150 Identity:34/150 - (22%)
Similarity:55/150 - (36%) Gaps:16/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RDDWSPEEDETLLAVATANRMQNWELIAASLDR---RSDYQCFVRFHTALRFLLEPKNSHRWSEE 290
            |..||.|||..|.|.......:.|.|::..:::   |....|..|:    :..|:|........|
plant     4 RQRWSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERW----KNYLKPGIKKGSLTE 64

  Fly   291 DNDKLRAIVDRNTANSVINWKKVVEYFPDKSKSTLIGRYYYVLHPSISHEPFTTKEDMMLFAAVE 355
            :..:|...:.....|   .|||:....|.::...| |:::.|.......|   .||.......::
plant    65 EEQRLVIRLQEKHGN---KWKKIAAEVPGRTAKRL-GKWWEVFKEKQQRE---EKESNKRVEPID 122

  Fly   356 E--YNGKFHCFPRSLFPNRS 373
            |  |:.....|...|...||
plant   123 ESKYDRILESFAEKLVKERS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 6/10 (60%)
SANT 229..276 CDD:197842 13/49 (27%)
Myb_DNA-bind_6 287..350 CDD:372817 13/62 (21%)
SANT 392..438 CDD:197842
AS1NP_181299.1 PLN03212 3..>122 CDD:178751 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.