DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and MYB7

DIOPT Version :10

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_179263.1 Gene:MYB7 / 816173 AraportID:AT2G16720 Length:269 Species:Arabidopsis thaliana


Alignment Length:117 Identity:34/117 - (29%)
Similarity:56/117 - (47%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SCEAMWRVYLTPDLRRDDWSPEEDETLLAVAT--ANRMQNWELIAASLDRRSDYQCFVRFHTALR 276
            ||...|..||.|||:|.:::.:|||.::.:.:  .|:   |.||||.|..|:|.:....::|.::
plant    52 SCRLRWINYLRPDLKRGNFTHDEDELIIKLHSLLGNK---WSLIAARLPGRTDNEIKNYWNTHIK 113

  Fly   277 FLLEPKN----SHRWSEEDNDKLRAIVD-RNTANSVINWKKVVEYFPDKSKS 323
            ..|..|.    :||...|     ..|.| :.|.:.::.....|..|.:..||
plant   114 RKLLSKGIDPATHRGINE-----AKISDLKKTKDQIVKDVSFVTKFEETDKS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 SANT <194..240 CDD:473887 12/25 (48%)
SANT 229..276 CDD:197842 14/48 (29%)
Myb_DNA-bind_6 287..350 CDD:372817 8/38 (21%)
SANT 392..438 CDD:197842
MYB7NP_179263.1 PLN03091 1..>133 CDD:215570 27/88 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.