DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and ttf1.6

DIOPT Version :9

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:XP_005168698.1 Gene:ttf1.6 / 449954 ZFINID:ZDB-GENE-041008-214 Length:549 Species:Danio rerio


Alignment Length:387 Identity:74/387 - (19%)
Similarity:127/387 - (32%) Gaps:141/387 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 ISHEPFTTKEDMML------FAAVEEYNGKFHCFPRSLFPNRS--LTQLRTRY------------ 381
            :.|..|:|.|:..|      |.|:.........|....||..|  |..|:.:|            
Zfish   210 LRHGRFSTAENERLRQNVSNFLALTGVKDAIKLFHPKRFPKESQTLANLKRKYSFFVKIAEGIPR 274

  Fly   382 --HNVLAQ-------RNKTDSWSVQDDTRLMSFVTQYG-----------------ASQWLNCATF 420
              |:|..:       |||..:::.:::..|:.:.|.||                 ..::.:.:..
Zfish   275 PCHDVYTRGTKIYDDRNKKGNFTEEEEKSLLKYYTLYGPDWKKISDKTDRSSYSLEKRFSHLSKI 339

  Fly   421 LGNHTRTSCR-----TRFLVIKKFLEQNPNAKVEDLPRRRSKKV-----------SLVNSDNWAQ 469
            .|..|....:     .|..|:......||..|   .|:|.|:::           ..|.:..|.:
Zfish   340 RGPWTTNEVQRLLRAVRDHVVSVLKSANPKKK---KPKRVSREILYQALPWSKIAEKVKTRCWTK 401

  Fly   470 RLQEWQEDPESLVNDNPPKGTRVRGPKSKKARI-------ERQAESFSRLSKVDIEFCNFFKFSY 527
            ...:|.    |::......|...||.|:::|:|       |.|.|..     ||:::       .
Zfish   402 CRDKWM----SILASRMSSGITFRGRKAQEAKIKLIRAMYEMQVEDV-----VDVDW-------E 450

  Fly   528 NLTLSTPKTFPVPKDVYNLAYVIRALAYKPPI----RPSLLQNIFMPNDVLKCYNSMI------- 581
            :||       .|..||             ||.    |...|:..::|:...||:..::       
Zfish   451 HLT-------AVFGDV-------------PPAYAQSRWHQLKVCYVPDWQNKCFGDIVDFLYENT 495

  Fly   582 --------RNLPDEEGDMKSPLLPPNWSTMMGFRALCI---LSGD--CRKDTETRSFEYNES 630
                    ::|.|:|..:         ..|..||...|   ::.|  |..|.:|...|.|.|
Zfish   496 LPGLVKECKDLDDDELTV---------DQMNSFRLADIFQDINEDECCDDDEQTGQQENNHS 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392
SANT 229..276 CDD:197842
Myb_DNA-binding 229..275 CDD:278669
Myb_DNA-bind_6 287..350 CDD:290632 4/12 (33%)
SANT 392..438 CDD:197842 8/67 (12%)
Myb_DNA-binding 393..437 CDD:278669 8/65 (12%)
ttf1.6XP_005168698.1 Myb_DNA-bind_6 296..351 CDD:290632 6/54 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.