DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and rtf1

DIOPT Version :9

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_594730.2 Gene:rtf1 / 2541545 PomBaseID:SPAC22F8.07c Length:466 Species:Schizosaccharomyces pombe


Alignment Length:411 Identity:84/411 - (20%)
Similarity:146/411 - (35%) Gaps:132/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RKGTFRFKGNLFFRDIDGRSCPNNEDYEARCHTEMFPTDFDMHSRHVWTLLDKKNVIMGIKQQLL 156
            :.||..:|..:|.||                :|...||.:.:.|:.:...|.:..:.....:.||
pombe    81 KTGTTSYKDFVFSRD----------------YTNWTPTFWVLLSQLIDEFLKESELNFVAARDLL 129

  Fly   157 EHRAHSTNALPS-------------GSLKRKPIERHLSTLVSL-------LATADSSFSIDWNQI 201
                ..|..||.             .::.|:.:.|||....::       .....||.|...|.|
pombe   130 ----IKTKRLPKPFNNLLIQFQIQVPNVSRRTVYRHLKGYFNIPGYERFQYVKKASSGSWGANDI 190

  Fly   202 STLDLEYRHSPYSCEAMWRVYLTPDLRRDDWSPEEDETLLAVATANRMQN---------WELIAA 257
            .||:.|.        ||::       ::.:||   ||..|....::..::         :|||  
pombe   191 ITLEKEI--------AMFK-------KKKNWS---DEQFLQYVWSDNHRDEMKTLYNCLYELI-- 235

  Fly   258 SLDRRSDYQCFVRFHTALRFLLEPKNSHRWSEEDNDKLRAIVDRNTANSVINWKKVVEYFPDKSK 322
            ..|::|.|....|.:...      |...:|:.||..:|:.:|:::..    :|            
pombe   236 DRDKKSIYNYLRRKYNPF------KKKCKWTIEDEAELKKLVEKHGT----SW------------ 278

  Fly   323 STLIGRYY-------------YVLHPSISHEPFTTKEDMMLFAAVEEYNGKFHCFPRSLFP---- 370
             :|||:..             |:....|:..|:|.:|...|...|.:|   ....|.|...    
pombe   279 -SLIGKLSNRLPMHCRDHWRDYIQPGEINRSPWTIQEKEKLIKTVNQY---LQSNPSSPIQWSLI 339

  Fly   371 -----NRSLTQLRTRYHNVLAQ--RNKT-----DS-WSVQDDTRLMSF-VTQYGASQWLNCATFL 421
                 ||.....|.:|:.::::  .|.:     || |.::   |:|.. |.:.....| .|.:..
pombe   340 SKNMRNRHRHHCRWKYYTLISRDIHNSSPFKLGDSIWLIE---RMMDLNVAEERMIDW-KCLSEY 400

  Fly   422 GNH--TRTSCRTRFLVIKKFL 440
            .||  |..:|::.|..|||.|
pombe   401 ANHLWTADACKSHFERIKKTL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392 12/45 (27%)
SANT 229..276 CDD:197842 12/55 (22%)
Myb_DNA-binding 229..275 CDD:278669 12/54 (22%)
Myb_DNA-bind_6 287..350 CDD:290632 14/75 (19%)
SANT 392..438 CDD:197842 14/49 (29%)
Myb_DNA-binding 393..437 CDD:278669 12/47 (26%)
rtf1NP_594730.2 REB1 1..466 CDD:227476 84/411 (20%)
Myb_DNA-bind_6 259..318 CDD:290632 14/75 (19%)
Myb_DNA-binding 307..359 CDD:278669 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.