DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pbp95 and Dmtf1l

DIOPT Version :9

Sequence 1:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_808373.1 Gene:Dmtf1l / 237029 MGIID:3045322 Length:470 Species:Mus musculus


Alignment Length:416 Identity:76/416 - (18%)
Similarity:127/416 - (30%) Gaps:146/416 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PNNED--YEARCHTEMFPTDFDMHSRHVW---------TLLDKKNVIMGIKQQLLEHRAHSTNAL 166
            ||.|:  ......|.....|...|....|         |.:...|:...:|...:|:.|.....:
Mouse   100 PNKEESVVSQAWFTSKEAKDALTHQGQKWKQGMWSKEETAILMNNIERYMKDHGVENPAEIIFKM 164

  Fly   167 PSGSLKRKPIERHLSTLVSLLATADSSFSIDWNQISTLDLEYRHSPYSCEAMWRVYLTPDLRRDD 231
            ..|  |||...|.:|     |......||:           ||.       :.|:|       ||
Mouse   165 AKG--KRKDFYRSVS-----LGLNRPLFSV-----------YRR-------VVRMY-------DD 197

  Fly   232 ------WSPEEDETLLAVATANRMQNWELIAASLDRRSDY---QCFVRFHTALRFLLEPKNSHRW 287
                  :||||.|.|..: ......:|..|.|::.|....   :|        |.:.:..|:.:|
Mouse   198 RNHVGKYSPEEIEKLKEL-WQKHGNDWITIGAAMGRSPSSVKDRC--------RLMKDTCNTGKW 253

  Fly   288 SEEDNDKLRAIVDRNTANSVINWKKVVEYFPDKSKSTLIGRYYYVLHPSISHEPFTTKEDMMLFA 352
            :||:...|..:|...|...|                          ...::|.        :.:|
Mouse   254 TEEEEQLLGDVVHELTCTEV--------------------------DEKVTHG--------VCWA 284

  Fly   353 AVEEYNGKFHCFPRSLFPNRSLTQLRTRYHNVLAQRNKTD-SWSVQDDTRLMSFVTQYGAS---- 412
            .|.:..|           .||..|.|.::.|.|..:.... .|:.:|:..|:..:.:...|    
Mouse   285 TVAQRVG-----------TRSAKQCRAKWLNYLNWKQTGGIEWTRKDEVTLIQRLVELDVSDESE 338

  Fly   413 ----------------QWLNCATFLGNHTRTSCRTRFLVIKKFLEQNPNAKVEDLPRRRSKKVSL 461
                            |||              |.::.:||:.:..:.:.....|.|...::...
Mouse   339 IRWDELAKGWESVRSPQWL--------------RNKWWIIKRQITNHKDFAFPVLVRCLQQEYES 389

  Fly   462 VNSDNWAQRLQEWQEDPESLVNDNPP 487
            .|:.     |:.|:....|.|.|:.|
Mouse   390 QNAS-----LRFWENKSGSEVPDSNP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392 13/51 (25%)
SANT 229..276 CDD:197842 13/55 (24%)
Myb_DNA-binding 229..275 CDD:278669 13/54 (24%)
Myb_DNA-bind_6 287..350 CDD:290632 8/62 (13%)
SANT 392..438 CDD:197842 9/66 (14%)
Myb_DNA-binding 393..437 CDD:278669 8/63 (13%)
Dmtf1lNP_808373.1 SANT 202..247 CDD:197842 12/53 (23%)
Myb_DNA-bind_6 205..261 CDD:290632 16/64 (25%)
SANT 251..307 CDD:197842 16/100 (16%)
Myb_DNA-binding 251..306 CDD:278669 16/99 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.