DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and AT5G09340

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_196496.1 Gene:AT5G09340 / 830793 AraportID:AT5G09340 Length:79 Species:Arabidopsis thaliana


Alignment Length:56 Identity:12/56 - (21%)
Similarity:21/56 - (37%) Gaps:15/56 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVYALLKNKLSDVHPLHNIDLTRDVAYLKAVVTKEMHLQFDASELEIIHHGRVLED 58
            |..|.:|.|:.|...:.|       ||        .:|:.....:..:|.|..::|
plant    21 TTIADMKTKIYDATGMEN-------AY--------QYLEHRGKIVLEVHGGTTMDD 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 10/50 (20%)
UBA_like_SF 373..410 CDD:473871
AT5G09340NP_196496.1 Ubl_ubiquitin_like 3..72 CDD:340559 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.