DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and UBL4A

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_055050.1 Gene:UBL4A / 8266 HGNCID:12505 Length:157 Species:Homo sapiens


Alignment Length:146 Identity:30/146 - (20%)
Similarity:65/146 - (44%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VAYLKAVVTKEMHLQFDASELEIIHHGRVLEDADTL-NRTLQPNA----VIHCFQKI-------K 79
            |:.||.:|::::::  ...:..::..|:.|.|...| :.::.||:    |:...:|:       :
Human    23 VSTLKQLVSEKLNV--PVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQ 85

  Fly    80 RYSPYVPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQKILAEYPEFRRNLGAQALIRDSVLF 144
            |.:...||...::.:|      .|..|...:..||  :|:::..:|   .|:|....|.....|.
Human    86 RLADSPPPQVWQLISK------VLARHFSAADASR--VLEQLQRDY---ERSLSRLTLDDIERLA 139

  Fly   145 NMLHEPEVVQNLVKDY 160
            :....|||.:.:.|.:
Human   140 SRFLHPEVTETMEKGF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 11/52 (21%)
UBA_like_SF 373..410 CDD:473871
UBL4ANP_055050.1 Ubl_UBL4A_like 1..72 CDD:340505 11/50 (22%)
Tugs 96..142 CDD:465528 11/56 (20%)
Required and sufficient for interaction with BAG6. /evidence=ECO:0000269|PubMed:25535373, ECO:0000269|PubMed:25713138 96..138 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.