DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and AT4G01000

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_192009.1 Gene:AT4G01000 / 826414 AraportID:AT4G01000 Length:415 Species:Arabidopsis thaliana


Alignment Length:76 Identity:20/76 - (26%)
Similarity:31/76 - (40%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 GSSSGAISSGSISSELLRNELARAFQSLSQDQPAPVENMEVESGEGPVPEQAATAPAD-DVDDED 356
            |.|||..|..|.|.|.....:.|:|..:.:         |:...:|.:.|:....|.. .|||.:
plant   240 GDSSGKSSCNSGSEEENDAVMHRSFDVVKE---------EITGVQGIIEEEMNDLPVSVAVDDAN 295

  Fly   357 DGGDDSDVLPR 367
            ...|:.|.|.:
plant   296 TVADEMDQLEK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559
UBA_like_SF 373..410 CDD:473871
AT4G01000NP_192009.1 Ubl1_cv_Nsp3_N-like 10..156 CDD:475130
SDE2_2C 351..402 CDD:463835
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.