DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and UBQ5

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_191784.1 Gene:UBQ5 / 825398 AraportID:AT3G62250 Length:157 Species:Arabidopsis thaliana


Alignment Length:118 Identity:21/118 - (17%)
Similarity:47/118 - (39%) Gaps:28/118 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YLKAVVTKEMHLQFDASEL-------------------EIIHHGRVLEDADTL-NRTLQPNAVIH 73
            ::|.:..|.:.|:.::|:.                   .:|..|:.|||..|| :..:|..:.:|
plant     4 FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH 68

  Fly    74 CFQKI------KRYSPYVPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQK 120
            ...::      ::...|..|  .:|..||.:...::....:|..:.:...|:|
plant    69 LVLRLRGGAKKRKKKTYTKP--KKIKHKHKKVKLAVLQFYKIDGSGKVQRLRK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 13/65 (20%)
UBA_like_SF 373..410 CDD:473871
UBQ5NP_191784.1 Ubl_ubiquitin 1..76 CDD:340501 13/71 (18%)
Ribosomal_S27 103..147 CDD:460261 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.