DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and UBQ6

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_566095.1 Gene:UBQ6 / 819323 AraportID:AT2G47110 Length:157 Species:Arabidopsis thaliana


Alignment Length:118 Identity:20/118 - (16%)
Similarity:47/118 - (39%) Gaps:28/118 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YLKAVVTKEMHLQFDASEL-------------------EIIHHGRVLEDADTL-NRTLQPNAVIH 73
            ::|.:..|.:.|:.::|:.                   .:|..|:.|||..|| :..:|..:.:|
plant     4 FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH 68

  Fly    74 CFQKI------KRYSPYVPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQK 120
            ...::      ::...|..|  .:|..||.:...::....::..:.:...|:|
plant    69 LVLRLRGGAKKRKKKTYTKP--KKIKHKHKKVKLAVLQFYKVDGSGKVQRLRK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 13/65 (20%)
UBA_like_SF 373..410 CDD:473871
UBQ6NP_566095.1 Ubl_ubiquitin 1..76 CDD:340501 13/71 (18%)
Ribosomal_S27 103..147 CDD:460261 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.