DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and NEDD8

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_006147.1 Gene:NEDD8 / 4738 HGNCID:7732 Length:81 Species:Homo sapiens


Alignment Length:40 Identity:11/40 - (27%)
Similarity:16/40 - (40%) Gaps:6/40 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 PVENME-----VESGEG-PVPEQAATAPADDVDDEDDGGD 360
            |.:.:|     ||..|| |..:|........::||....|
Human    19 PTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAAD 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559
UBA_like_SF 373..410 CDD:473871
NEDD8NP_006147.1 Ubl_NEDD8 3..76 CDD:340504 11/40 (28%)
Interaction with UBE1C. /evidence=ECO:0000269|PubMed:14690597 70..72
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.