DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and Nedd8

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_609919.1 Gene:Nedd8 / 35151 FlyBaseID:FBgn0032725 Length:84 Species:Drosophila melanogaster


Alignment Length:61 Identity:10/61 - (16%)
Similarity:25/61 - (40%) Gaps:9/61 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DVHPLHNIDLTRD-VAYLKAVVTKEMHLQFDASELEIIHHGRVLEDADTLNRTLQPNAVIH 73
            |:.|...:|..:: |...:.:..::..|.|...::.        :|....:..:|..:|:|
  Fly    16 DIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMN--------DDKTAADYKVQGGSVLH 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 10/61 (16%)
UBA_like_SF 373..410 CDD:473871
Nedd8NP_609919.1 Ubl_NEDD8 3..76 CDD:340504 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.