DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and C16C8.5

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_494543.1 Gene:C16C8.5 / 182672 WormBaseID:WBGene00015843 Length:180 Species:Caenorhabditis elegans


Alignment Length:141 Identity:33/141 - (23%)
Similarity:55/141 - (39%) Gaps:31/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKNKLSDVHPLHNIDLTRDVAYLKAVVTKEM-----HLQFDASELEIIHHGRVLEDADTL----N 63
            |::|..:...|....|..||..|.|.:.:|.     .|| ...|.:.|.:.::.|:.:.|    |
 Worm    16 LESKFPNGSTLVENQLLLDVKSLCAELLEEQKSLKKRLQ-KVEENQKIENAKIKEELENLKNGGN 79

  Fly    64 RTLQPNAV--IHCFQKIKRYSPYVPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQKILAEYP 126
            | :..|::  |..|...|.:       |.|:...:      |..::::.|.   |:|...|.|  
 Worm    80 R-VADNSLFEIFVFDDYKYH-------AVEVRNSY------LIRYVRVKVA---NLLNNDLVE-- 125

  Fly   127 EFRRNLGAQAL 137
            .|....|.|.|
 Worm   126 SFNLYYGGQKL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559 18/76 (24%)
UBA_like_SF 373..410 CDD:473871
C16C8.5NP_494543.1 UBQ 87..154 CDD:214563 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.