DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and LOC1272322

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_311268.6 Gene:LOC1272322 / 1272322 VectorBaseID:AGAMI1_011087 Length:390 Species:Anopheles gambiae


Alignment Length:82 Identity:23/82 - (28%)
Similarity:32/82 - (39%) Gaps:20/82 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 AAWAIKEN--FIQFATDAYYTAPMQLSSHLHSSSGSRVFQYVNNYNFSRQHPNLLFIPDWMGVCR 531
            |...|.||  :|.||.:.::             ...||..:..||..:.    |.|||.::.: .
Mosquito   108 AILGIFENRFYIMFAENTFW-------------KFVRVSYFAFNYILAL----LFFIPPYLRI-P 154

  Fly   532 DCDLYLMFGYPFLPDEL 548
            |.||.|...|..||..|
Mosquito   155 DQDLALQQIYKELPSNL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559
UBA_like_SF 373..410 CDD:473871
LOC1272322XP_311268.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.