DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3223 and UBD

DIOPT Version :10

Sequence 1:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_006389.2 Gene:UBD / 10537 HGNCID:18795 Length:165 Species:Homo sapiens


Alignment Length:120 Identity:29/120 - (24%)
Similarity:54/120 - (45%) Gaps:24/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NTKHIQELFSLTSHLQISVTSRFNIL-QKILAEYPEFRRNLGAQALIRDSVLFNMLHEPEVVQNL 156
            :.|.|:|  .:.|..::.|..:..:| .|||..    ||:|.:..:.::..:...|   :||:..
Human    29 SVKKIKE--HVRSKTKVPVQDQVLLLGSKILKP----RRSLSSYGIDKEKTIHLTL---KVVKPS 84

  Fly   157 VKDYPLICEAAPFIV---DTIRKEL---ARNSSATQLQEQAASESTTSSEEENSL 205
            .::.||      |:|   |..::.|   .|:||..|:  :|..|:.|....|..:
Human    85 DEELPL------FLVESGDEAKRHLLQVRRSSSVAQV--KAMIETKTGIIPETQI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3223NP_649758.1 Ubl_ubiquitin_like 9..75 CDD:340559
UBA_like_SF 373..410 CDD:473871
UBDNP_006389.2 Ubl1_FAT10 9..82 CDD:340572 14/61 (23%)
Ubl2_FAT10 90..159 CDD:340573 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.