DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR7A2

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_003680.2 Gene:AKR7A2 / 8574 HGNCID:389 Length:359 Species:Homo sapiens


Alignment Length:328 Identity:78/328 - (23%)
Similarity:131/328 - (39%) Gaps:100/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AIDAALEAGYRHIDTAPVY--GNEKAIGRVLKRWLDAG--KVKREELFIVTKVPP---VSNRPHE 90
            |:.|.||.|:..:|||.:|  |..:.|...|...|..|  :||     |.||..|   .|.:|..
Human    59 AVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVK-----IATKANPWDGKSLKPDS 118

  Fly    91 VEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEK 155
            |...::.||:.||...|||:.:|.|      :.|:         .|:.|.:      |.:.|.::
Human   119 VRSQLETSLKRLQCPQVDLFYLHAP------DHGT---------PVEETLH------ACQRLHQE 162

  Fly   156 GLTKSIGVSNFSKDQVARLLKNCK----IRPANNQIEHHVYLQQ--RDLVDFCKSENITVTAYSP 214
            |....:|:||::..:||.:...||    |.|...|..::...:|  .:|....:...:...||:|
Human   163 GKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNP 227

  Fly   215 L---------------GSKGIAKF--NAGAGIVRDL------PDLMDIPEVKEIAASHGKTPAQV 256
            |               |.:.:.:|  |:.|...|:.      .:.:.:.| |.:.|::|.:...|
Human   228 LAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVE-KALQAAYGASAPSV 291

  Fly   257 ---LLRWI-------------IDTGVSAIPKSTNPARLKQNL-------------DVFD--FELT 290
               .|||:             :..|:|::      .:|:|||             |.|:  :.|.
Human   292 TSAALRWMYHHSQLQGAHGDAVILGMSSL------EQLEQNLAATEEGPLEPAVVDAFNQAWHLV 350

  Fly   291 AEE 293
            |.|
Human   351 AHE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 78/328 (24%)
Tas 10..297 CDD:223739 78/328 (24%)
AKR7A2NP_003680.2 Aldo_ket_red 26..346 CDD:119408 75/319 (24%)
Tas 42..355 CDD:223739 78/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.