DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and ARA1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:119/334 - (35%)
Similarity:178/334 - (53%) Gaps:41/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIET--AIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :.:.|||.::|.:|:||....::..||  |:.||::|||||||||..|..|..:|..:|..|:.|
Yeast    24 YFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDG 88

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .:|||:|||.|||.||  ...||:.::.:||:.|.|:||||.|.|.|......:|..   ...||
Yeast    89 SIKREDLFITTKVWPV--LWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPK---GISGL 148

  Fly   134 MEVDVTTNHAAIWVAMEALVE--KGLTK-----------SIGVSNFSKDQVARLLKNCKIRPANN 185
            ::..|..:...::.|....:|  |.|.|           :|||||||.:.:.||:|.|:::|..|
Yeast   149 VKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVN 213

  Fly   186 QIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHG 250
            |:|.|.:|.|.:|..||...:|.:||||||||.|             .|:| .||.||::|..:.
Yeast   214 QVETHPHLPQMELRKFCFMHDILLTAYSPLGSHG-------------APNL-KIPLVKKLAEKYN 264

  Fly   251 KTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQN--IRICDFAFFH 313
            .|...:|:.:.|..|...||:|.||.|:..:::.  ..||.:|:.:|:...:.  :|..|..|  
Yeast   265 VTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEF--ASLTKDELQELNDFGEKYPVRFIDEPF-- 325

  Fly   314 GVERHPEFT 322
             ....||||
Yeast   326 -AAILPEFT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 112/310 (36%)
Tas 10..297 CDD:223739 111/301 (37%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 113/317 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.