DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AT1G59950

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_176203.1 Gene:AT1G59950 / 842289 AraportID:AT1G59950 Length:320 Species:Arabidopsis thaliana


Alignment Length:311 Identity:118/311 - (37%)
Similarity:175/311 - (56%) Gaps:25/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNG---EKMPVIGIGTWQASDEE---IETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWL 65
            |||..|   ..|||:.:||..:...|   ::..:..|::.||||.||:|.|..|:.:|..|...:
plant     4 LTFPIGSVHHLMPVLALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTSPRYQTEEPLGEALAEAV 68

  Fly    66 DAGKVK-REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFK-- 127
            ..|.:: |.|||:.:|:.........|.|.|::|||.|:|||:||||:|.|.:   ::.|.:|  
plant    69 SLGLIQSRSELFVTSKLWCADAHGGLVVPAIQRSLETLKLDYLDLYLIHWPVS---SKPGKYKFP 130

  Fly   128 LDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY 192
            ::::..:.:|..|    :|..||.....|:.|.|||||||..::..:|...||.|:.||:|....
plant   131 IEEDDFLPMDYET----VWSEMEECQRLGVAKCIGVSNFSCKKLQHILSIAKIPPSVNQVEMSPV 191

  Fly   193 LQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVL 257
            .|||.|.:.|||:.|.|||||.|||:|     |..|..:    :|:...:||||.:.|||.|||.
plant   192 WQQRKLRELCKSKGIVVTAYSVLGSRG-----AFWGTHK----IMESDVLKEIAEAKGKTVAQVS 247

  Fly   258 LRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICD 308
            :||..:.|||.:.||....||::||.:||:.||.||..::|:.....||.|
plant   248 MRWAYEEGVSMVVKSFRKDRLEENLKIFDWSLTEEEKQRISTEISQSRIVD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 115/303 (38%)
Tas 10..297 CDD:223739 111/295 (38%)
AT1G59950NP_176203.1 AKR_AKR4A_4B 12..293 CDD:381350 111/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.