DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AT5G62420

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:293 Identity:106/293 - (36%)
Similarity:164/293 - (55%) Gaps:17/293 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GEKMPVIGIGTW--QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREE 74
            ||.:|::|:||:  |...|...:|:..|::.||||.|||.:||:|:|:|..|.:.:..|.|:|::
plant    11 GETIPLLGMGTYCPQKDRESTISAVHQAIKIGYRHFDTAKIYGSEEALGTALGQAISYGTVQRDD 75

  Fly    75 LFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVT 139
            ||:.:|:  .|:..|:....:.::|:.:.|||:|.||||.|  |.:....|..:.||...|.|:.
plant    76 LFVTSKL--WSSDHHDPISALIQTLKTMGLDYLDNYLVHWP--IKLKPGVSEPIPKEDEFEKDLG 136

  Fly   140 TNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFCKS 204
            ....  |..||..:|.||.:||||||||..::..||....:.|:.||:|.|...:||.|...|:.
plant   137 IEET--WQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQVEMHPLWRQRKLRKVCEE 199

  Fly   205 ENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAI 269
            .||.|:.|||||..|    |......     :::.|.:|.||..|..|||||.|||.:..|.|.|
plant   200 NNIHVSGYSPLGGPG----NCWGSTA-----VIEHPIIKSIALKHNATPAQVALRWGMSKGASVI 255

  Fly   270 PKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQ 302
            .||.|.||:.:|....:.:|..::::.:..|::
plant   256 VKSFNGARMIENKRALEIKLDDQDLSLIDHLEE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 106/291 (36%)
Tas 10..297 CDD:223739 105/286 (37%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 106/291 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.