DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR1E2

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:326 Identity:124/326 - (38%)
Similarity:185/326 - (56%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFIVTKVPPVSNRP 88
            |||..::..|:..|::|||||.|.|..|.||:.:|..::..:..|.|:||:|||.||:....::.
Human    34 QASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKK 98

  Fly    89 HEVEPTIKKSLEDLQLDYVDLYLVHTP------------------FTININEDGSFKLDKEGLME 135
            ..||...:|||:.|:|:|:||||:|.|                  |.::........|| |..|.
Human    99 SLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLD-ESNMV 162

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDL 198
            :...|:....|.|||.||..||.|:||||||:.:|:.|||.  ..:.:|..||||.|.||.|::|
Human   163 IPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNL 227

  Fly   199 VDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWI 261
            :.||:|.:::||||.|||.  :|:              ||:|.|.:|.||..|||:|||:|:|:.
Human   228 ISFCQSRDVSVTAYRPLGGSCEGV--------------DLIDNPVIKRIAKEHGKSPAQILIRFQ 278

  Fly   262 IDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQ 326
            |...|..||.|..|:.:|:|:.|||||||..::..:.||::|:|:   |.|...:.|.::.|..:
Human   279 IQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRL---AMFPITKNHKDYPFHIE 340

  Fly   327 Y 327
            |
Human   341 Y 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 117/299 (39%)
Tas 10..297 CDD:223739 115/294 (39%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 118/302 (39%)
Tas 42..314 CDD:223739 112/286 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.