DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR4C10

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_181315.2 Gene:AKR4C10 / 818356 AraportID:AT2G37790 Length:314 Species:Arabidopsis thaliana


Alignment Length:309 Identity:131/309 - (42%)
Similarity:188/309 - (60%) Gaps:16/309 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK 69
            :|...|.|.|:|.:|:|||||....:..|:|||::.||||||.|.:|||||.||.|||:..|.|.
plant     6 RFFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGLVLKKLFDGGV 70

  Fly    70 VKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLM 134
            |||||:||.:|:....:.|.||...:.::|:|||||||||||:|.|.::   :.||.....|.::
plant    71 VKREEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSL---KKGSTGFKPENIL 132

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199
            ..|:.:.    |.|||:|.:.|..::|||||||..::|.||...::.||.||:|.|...||..|.
plant   133 PTDIPST----WKAMESLFDSGKARAIGVSNFSSKKLADLLVVARVPPAVNQVECHPSWQQNVLR 193

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            |||||:.:.::.||||||.|.....:         |::..|.:..:|...|||||||.|||.:..
plant   194 DFCKSKGVHLSGYSPLGSPGTTWLTS---------DVLKNPILGGVAEKLGKTPAQVALRWGLQM 249

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFH 313
            |.|.:||||:..|:|||.|||::.:..:.::|.|.:.|...:...:|.|
plant   250 GQSVLPKSTHEDRIKQNFDVFNWSIPEDMLSKFSEIGQGRLVRGMSFVH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 128/296 (43%)
Tas 10..297 CDD:223739 125/286 (44%)
AKR4C10NP_181315.2 AKR_AKR4C1-15 6..292 CDD:381351 129/301 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.