DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and ChlAKR

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001031505.1 Gene:ChlAKR / 818354 AraportID:AT2G37770 Length:315 Species:Arabidopsis thaliana


Alignment Length:297 Identity:127/297 - (42%)
Similarity:183/297 - (61%) Gaps:16/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |...|.|.|.|.:|:||||||...:..|:.||::.||||||.|.:|||||.||.|||:..:...|
plant     7 FFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVV 71

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
            |||:|||.:|:....:.|.:|...:.::|:||||:||||||:|.|..|   :.||..:..|.|:.
plant    72 KREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARI---KKGSVGIKPENLLP 133

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVD 200
            ||:.:.    |.|||||.:.|..::|||||||..::|.||:..::.||.||:|.|...:|..|.:
plant   134 VDIPST----WKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQE 194

  Fly   201 FCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265
            ||||:.:.::|||||||.|.....:         |::..|.:..:|...||:||||.|||.:..|
plant   195 FCKSKGVHLSAYSPLGSPGTTWLKS---------DVLKNPILNMVAEKLGKSPAQVALRWGLQMG 250

  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQ 302
            .|.:|||||..|:|:|.:|||:.:.....||.:.::|
plant   251 HSVLPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIEQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 126/295 (43%)
Tas 10..297 CDD:223739 124/286 (43%)
ChlAKRNP_001031505.1 AKR_AKR4C1-15 6..291 CDD:381351 127/297 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.