DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR4C8

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_565871.1 Gene:AKR4C8 / 818353 AraportID:AT2G37760 Length:311 Species:Arabidopsis thaliana


Alignment Length:326 Identity:136/326 - (41%)
Similarity:193/326 - (59%) Gaps:41/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK 69
            :|...|.|.|:|.:|:||:..    :.|||:.|::.||||||.|.:|||||.||.|||:.:..|.
plant     6 RFFELNTGAKLPCVGLGTYAM----VATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGF 66

  Fly    70 VKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLM 134
            ||||||||.:|:....:.|.:|...::|:|:|||:|||||||:|.|.:          |.||.||
plant    67 VKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPAS----------LKKESLM 121

  Fly   135 -------EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY 192
                   :.|:|:.    |.|||||.:.|..::|||||||..::..||...::.||.||:|.|..
plant   122 PTPEMLTKPDITST----WKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPV 182

  Fly   193 LQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVL 257
            .||:.|.:.|||:.:.::.||||||:       ..|.||  ..::..|.|.|:|...|||.|||.
plant   183 WQQQGLHELCKSKGVHLSGYSPLGSQ-------SKGEVR--LKVLQNPIVTEVAEKLGKTTAQVA 238

  Fly   258 LRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQN--IRICDFA-----FFHGV 315
            |||.:.||.|.:|||::.||||:||||||:.:..:...|.|::.|.  .|..:||     |:..:
plant   239 LRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQEKFCRATEFAHETHGFYKTI 303

  Fly   316 E 316
            |
plant   304 E 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 130/303 (43%)
Tas 10..297 CDD:223739 127/293 (43%)
AKR4C8NP_565871.1 AKR_AKR4C1-15 6..288 CDD:381351 131/308 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.