DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AT2G21260

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_179722.1 Gene:AT2G21260 / 816665 AraportID:AT2G21260 Length:309 Species:Arabidopsis thaliana


Alignment Length:313 Identity:129/313 - (41%)
Similarity:181/313 - (57%) Gaps:12/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :|.|:|.|||:||:|.|:...||:...|..|::.||||:|.|..|.||..:|..|......|.||
plant     3 ITLNSGFKMPIIGLGVWRMEKEELRDLIIDAIKIGYRHLDCAANYKNEAEVGEALTEAFTTGLVK 67

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGS--FKLDKEGLM 134
            ||:|||.||:.. |:..|.:| ..|.||:.|||||:||:|||.|........|:  ..|..:|::
plant    68 REDLFITTKLWS-SDHGHVIE-ACKDSLKKLQLDYLDLFLVHIPIATKHTGIGTTDSALGDDGVL 130

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199
            ::|.|.:....|..||.||..||.:|||:||:........|...||:||.||||.|.|.|:..||
plant   131 DIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAVNQIETHPYFQRDSLV 195

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNA-GAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIID 263
            .||:...|.|||::|||.   |..|| ..|.|..|.|    |.:|::|..:.:|.||::|||.|.
plant   196 KFCQKHGICVTAHTPLGG---ATANAEWFGTVSCLDD----PVLKDVAEKYKQTVAQIVLRWGIQ 253

  Fly   264 TGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVE 316
            .....|||::.|.||::|..||||:|:.|::..:.|:::|.|....|.|.|:|
plant   254 RNTVVIPKTSKPERLEENFQVFDFQLSKEDMEVIKSMERNYRTHQTAKFWGIE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 123/297 (41%)
Tas 10..297 CDD:223739 121/289 (42%)
AT2G21260NP_179722.1 AKR_AKR2A1-2 1..308 CDD:381338 129/313 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.