DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr1c3

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001072181.1 Gene:akr1c3 / 779627 XenbaseID:XB-GENE-5821909 Length:324 Species:Xenopus tropicalis


Alignment Length:331 Identity:128/331 - (38%)
Similarity:194/331 - (58%) Gaps:23/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTW-------QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKR 63
            ::..|:|.||||||.||:       ..::|..:.|||    .||||||.|.:||||:.:||.::.
 Frog     8 YVELNDGHKMPVIGFGTYAPPKFPKSLAEEGTKVAID----VGYRHIDCAFLYGNEEEVGRAIRA 68

  Fly    64 WLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKL 128
            .:..|.||||::|...|:...|:.|..|.|.::|||:||||||:||:::|.|......:| .|..
 Frog    69 KIADGTVKREDVFYTGKLWSTSHTPERVRPALEKSLKDLQLDYMDLFIIHMPMEFKPGDD-LFPA 132

  Fly   129 DKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHV 191
            |:.|.. :...|:....|.|:|...:.||.:|||||||:..|:..:|.  ..|.:|..||:|.||
 Frog   133 DENGKF-IYHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHV 196

  Fly   192 YLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQV 256
            ||.|..|::||||::|.:..||.|||....::     |....|.|::.|.:.|||..|.:|||||
 Frog   197 YLNQSKLLEFCKSKDIVLVGYSVLGSSRDERW-----IEASTPVLLEDPALTEIAKKHNRTPAQV 256

  Fly   257 LLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEF 321
            .:|:.:..||..:.||..|||::||..||||:|.||::..:..|::|:|..|.:.:   ..||::
 Frog   257 AMRYHLQRGVVVLAKSFTPARIQQNFQVFDFQLDAEDMRSIDGLNRNMRYIDTSRW---SDHPKY 318

  Fly   322 TFKNQY 327
            .:..:|
 Frog   319 PYSEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 122/304 (40%)
Tas 10..297 CDD:223739 121/295 (41%)
akr1c3NP_001072181.1 AKR_AKR1C1-35 8..308 CDD:381334 124/310 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.