DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1cl

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_081858.2 Gene:Akr1cl / 70861 MGIID:1918111 Length:322 Species:Mus musculus


Alignment Length:328 Identity:119/328 - (36%)
Similarity:194/328 - (59%) Gaps:15/328 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFLTFNNGEKMPVIGIGTW---QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLD 66
            :::..::|..:||:|.||:   :.|...:..|...|::||:||||:|..|.||:.:|..::..:.
Mouse     5 RYMELSDGHHIPVLGFGTFVPGEVSKSMVAKATKIAIDAGFRHIDSAYFYQNEEEVGLAIRSKVA 69

  Fly    67 AGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKE 131
            .|.|:||::|..:|:|...:||..|:|.:::||..||||||||||:|.|.::....| ....|:.
Mouse    70 DGTVRREDIFYTSKLPCTCHRPELVQPCLEQSLRKLQLDYVDLYLIHCPVSMKPGND-LIPTDEN 133

  Fly   132 GLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQ 194
            |.:..| |.:....|.|||...:.||.||||||||::.|:..:|.  ..:.:|..||:|.|.||.
Mouse   134 GKLLFD-TVDLCDTWEAMEKCKDSGLAKSIGVSNFNRRQLEMILNKPGLRYKPVCNQVECHPYLN 197

  Fly   195 QRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLR 259
            |..|:|:|||::|.:.||..|||:....:     |..:.|.|::.|.:..:|..|.:|||.:.||
Mouse   198 QSKLLDYCKSKDIVLVAYGALGSQRCKNW-----IEENAPYLLEDPTLCAMAEKHKQTPALISLR 257

  Fly   260 WIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFK 324
            :::..|:..:.||.|..|:|:||.||:|.|.||::|.:..|::|.|   :|....:..||.:.|.
Mouse   258 YLLQRGIVIVTKSFNEKRIKENLKVFEFHLPAEDMAVIDRLNRNYR---YATARIISAHPNYPFL 319

  Fly   325 NQY 327
            ::|
Mouse   320 DEY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 112/301 (37%)
Tas 10..297 CDD:223739 111/291 (38%)
Akr1clNP_081858.2 ARA1 4..309 CDD:223729 115/313 (37%)
Tas 14..297 CDD:223739 110/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.