DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c12

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_038805.2 Gene:Akr1c12 / 622402 MGIID:1351661 Length:323 Species:Mus musculus


Alignment Length:334 Identity:117/334 - (35%)
Similarity:194/334 - (58%) Gaps:29/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            ::..|:|..:|.:|.||::..:.....:::|   ||:.||||:|||..|..|:.||:.::..:.|
Mouse     7 YVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKA 71

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTIN-------INEDGS 125
            |.||||:|||.||:.....||..|:|.::|||:.||||||||||:|.|..:.       ::|:|.
Mouse    72 GVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPVPMKPGDNESPLDENGK 136

  Fly   126 FKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIE 188
            |.||         |.:....|..:|...:.||.||||||||:..|:.|:|.  ..|.:|..||:|
Mouse   137 FLLD---------TVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVE 192

  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTP 253
            .|:||.|..|:|:|||::|.:.||..||::...::     :.::.|.|::.|.:.::|..:.::|
Mouse   193 CHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEW-----VDQNSPVLLNDPVLCDVAKRNKRSP 252

  Fly   254 AQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERH 318
            |.:.||::...|:..:.:|.....:::||.||:|:|:.|::..|..|::|.|.....|   :..|
Mouse   253 ALIALRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLPAEF---LADH 314

  Fly   319 PEFTFKNQY 327
            ||:.|..:|
Mouse   315 PEYPFSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 109/307 (36%)
Tas 10..297 CDD:223739 107/298 (36%)
Akr1c12NP_038805.2 Tas 6..297 CDD:223739 107/303 (35%)
ARA1 7..307 CDD:223729 111/313 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.