DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr1d1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001025609.1 Gene:akr1d1 / 594997 XenbaseID:XB-GENE-947167 Length:326 Species:Xenopus tropicalis


Alignment Length:341 Identity:119/341 - (34%)
Similarity:182/341 - (53%) Gaps:44/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIE----TAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            :..|:|..:||:|:||:.:.....:    .|:..|::.||||||.|.||.||..:|:.::..:..
 Frog    10 IPLNDGNSIPVLGLGTYSSPRTTPKGTCLEAVKLAIDLGYRHIDGAYVYYNEHEVGQAIREKIAE 74

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININED-------GS 125
            ||||||::|...|:....:.|..|.||::|:|:.|||||||||::..|......::       |.
 Frog    75 GKVKREDIFYCGKLWNTCHPPELVRPTLEKTLKTLQLDYVDLYIIELPMAFKPGDEIYPRDANGK 139

  Fly   126 FKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIE 188
            :...|         |:..|.|.|:|...:.||.||||||||::.|:..:|.  ..|.:||.||:|
 Frog   140 YLYHK---------TDLCATWEALEECKDAGLVKSIGVSNFNRRQLELILNKPGLKYKPATNQVE 195

  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRD-------LPDLMDIPEVKEIA 246
            .|.|..|..|::|....:|....|||:|:            .||       .|.|:..|.:..|.
 Frog   196 CHPYFTQPKLLEFSGQHDIVTVGYSPIGT------------CRDETWVNVSSPPLLKDPLLNAIG 248

  Fly   247 ASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAF 311
            ..:.||.|||.||:....||:.||||.||.|:|:|..:|||.||.:|:..:.:|::|:|..:...
 Frog   249 KKYNKTAAQVALRFNAQRGVAVIPKSFNPDRIKENFQIFDFSLTDKEMKDIEALNKNVRYVELLM 313

  Fly   312 FHGVERHPEFTFKNQY 327
            :   ..|||:.||::|
 Frog   314 W---SDHPEYPFKDEY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 111/314 (35%)
Tas 10..297 CDD:223739 110/306 (36%)
akr1d1NP_001025609.1 ARA1 9..309 CDD:223729 113/319 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.