DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1a1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_067448.1 Gene:Akr1a1 / 58810 MGIID:1929955 Length:325 Species:Mus musculus


Alignment Length:325 Identity:140/325 - (43%)
Similarity:201/325 - (61%) Gaps:15/325 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK-VKRE 73
            :.|:|||:||:|||::...:::.||..||.|||||||.|.|||||..||..||..:.:|| |.||
Mouse     9 HTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPRE 73

  Fly    74 ELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDV 138
            |||:.:|:....:.|.:|||.::|:|.||||:|:||||:|.|:... ..|..|..:.:|.:..| 
Mouse    74 ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFE-RGDNPFPKNADGTVRYD- 136

  Fly   139 TTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFCK 203
            :|::...|.|:|.||.|||.|::|:|||:..|:..:|....:|||..|:|.|.||.|.:|:..|.
Mouse   137 STHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCH 201

  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268
            :..:.|||||||||...|..:.      |.|.|::.|.|..:|..||::|||:||||.:...|..
Mouse   202 ARGLEVTAYSPLGSSDRAWRHP------DEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVIC 260

  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR-ICDFAFFHG--VER---HPEFTFKNQY 327
            ||||.||:|:.||:.||||..:.||:.:|.:|::|.| |.......|  |.|   ||.:.|.:.|
Mouse   261 IPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY 325

  Fly   328  327
            Mouse   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 130/292 (45%)
Tas 10..297 CDD:223739 128/287 (45%)
Akr1a1NP_067448.1 ARA1 1..303 CDD:223729 133/301 (44%)
Tas 9..291 CDD:223739 129/289 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.