DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1e1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_061347.2 Gene:Akr1e1 / 56043 MGIID:1914758 Length:301 Species:Mus musculus


Alignment Length:320 Identity:131/320 - (40%)
Similarity:191/320 - (59%) Gaps:25/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFI 77
            |.:|.:|:|||:||..|:..|:..|:..||||.|.|.:|.||..:|..:...:..|.||||:||:
Mouse     2 ENIPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKREDLFV 66

  Fly    78 VTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNH 142
            |:|:....::...|:.....:||.|.|||:||||:|.|......|. ...||:.|    .|..:|
Mouse    67 VSKLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEK-DIPLDRNG----KVIPSH 126

  Fly   143 AAI---WVAMEALVEKGLTKSIGVSNFSKDQVARLL--KNCKIRPANNQIEHHVYLQQRDLVDFC 202
            .:.   |.|||.||.:||.|::|||||:.:|:.|||  ...::||..||||.|.||.|:.|:|||
Mouse   127 TSFLDTWEAMEDLVFEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFC 191

  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVS 267
            ...|::||||.|||       .:|.|.     .|||...:::||..|||:|||:|:|:.|...:.
Mouse   192 HKRNVSVTAYRPLG-------GSGGGF-----HLMDDTVIRKIAKKHGKSPAQILIRFQIQRNLI 244

  Fly   268 AIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            .||||..|:|:::|:.|||||||.:::.:|.|||:|:|:   |.|...|.|.::.|..:|
Mouse   245 VIPKSVTPSRIRENIQVFDFELTEKDMEELLSLDKNLRL---ATFPTTENHQDYPFHIEY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 122/293 (42%)
Tas 10..297 CDD:223739 119/288 (41%)
Akr1e1NP_061347.2 Tas 4..287 CDD:223739 125/302 (41%)
ARA1 4..282 CDD:223729 123/294 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.