DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr1b1.2

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001070715.1 Gene:akr1b1.2 / 553452 ZFINID:ZDB-GENE-041210-132 Length:316 Species:Danio rerio


Alignment Length:328 Identity:138/328 - (42%)
Similarity:197/328 - (60%) Gaps:17/328 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :|.:..|.|..||::|:|||::...::..|:.||:.|||||||.|.||.||..:|..:|..:..|
Zfish     2 SKSVKLNTGADMPILGLGTWKSPPGKVAEAVKAAIAAGYRHIDGAAVYNNETEVGEGIKAMIKDG 66

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .|||||||:|:|:....:....|:...:|:|.||.|||:||||:|.|.......: .|.||.|||
Zfish    67 VVKREELFVVSKLWCTFHEKALVKGACQKTLSDLNLDYLDLYLIHWPMGFKSGSE-QFPLDSEGL 130

  Fly   134 MEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQR 196
            ...| .::....|..||.||:.||.|:||:|||:::|:..:|.  ..|.:|||||:|.|.||.|.
Zfish   131 TIGD-DSSFLDTWEGMEELVDAGLVKAIGISNFNREQIEAILNKPGLKYKPANNQVECHPYLTQD 194

  Fly   197 DLVDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLR 259
            .|:.:|:|:.|||||||||||  :..||        .:.|.|:|.|.:|.||..|.||.||||:|
Zfish   195 KLISYCQSKGITVTAYSPLGSPDRPWAK--------PEDPSLLDDPNIKAIAEKHKKTTAQVLIR 251

  Fly   260 WIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFK 324
            :.|...|..||||..|.|:::|..||||||:.|::..:.|.::|.|.|.   .|...:|.::.|.
Zfish   252 FQIQRNVIVIPKSITPQRIQENFQVFDFELSEEDMKTILSFNRNFRACP---MHWGVKHRDYPFN 313

  Fly   325 NQY 327
            .:|
Zfish   314 AEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 131/300 (44%)
Tas 10..297 CDD:223739 129/290 (44%)
akr1b1.2NP_001070715.1 ARA1 1..306 CDD:223729 135/316 (43%)
Tas 8..289 CDD:223739 129/290 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.