DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and XB5731323

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_031755921.1 Gene:XB5731323 / 548351 XenbaseID:XB-GENE-5731324 Length:284 Species:Xenopus tropicalis


Alignment Length:318 Identity:107/318 - (33%)
Similarity:170/318 - (53%) Gaps:46/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNTKFLT--FNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKR 63
            |..:|..|  ..:|:.:|::|:|............:.|....|.||||||..||||..:|:.:  
 Frog     1 MARSKIPTVPLASGQHIPLLGLGMSHVGGYCHNALLYALTTCGIRHIDTAKRYGNEVMVGKAI-- 63

  Fly    64 WLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLED---LQLDYVDLYLVHTPFTININEDGS 125
             .::| ||||||::.||:.|   ..:..|..|:..|:.   |.:||:||||:|.|       |..
 Frog    64 -CESG-VKREELWLTTKLWP---GDYGYENAIQACLDSCKRLGVDYLDLYLMHWP-------DAQ 116

  Fly   126 F--KLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIE 188
            .  |..:|.         .|..|.|:|.|.|:|:.:|||||||....:.:|.::|.:.|..||:|
 Frog   117 IPGKSAREA---------RAETWQALEELNERGICRSIGVSNFLIHHLDQLKEDCNMVPHLNQVE 172

  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTP 253
            :|.:.:.::|||:|:..||....|.|| :||.|               ::.|.:::||.::||||
 Frog   173 YHPFQRPQELVDYCRRNNIVFEGYCPL-AKGQA---------------LNHPVIQKIAKNYGKTP 221

  Fly   254 AQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAF 311
            |||.:||.|..|:..|||||...|:::|.:||:|:|..|.:..::||:.|.::....:
 Frog   222 AQVCIRWSIQNGIVTIPKSTKEERIQENCEVFNFQLEQEHMDCITSLNSNRKLIHLTY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 105/303 (35%)
Tas 10..297 CDD:223739 101/291 (35%)
XB5731323XP_031755921.1 AKR_CeZK1290-like 5..268 CDD:381361 103/301 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.