DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and zgc:110782

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:303 Identity:114/303 - (37%)
Similarity:170/303 - (56%) Gaps:31/303 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NGEKMPVIGIGTWQASD-EEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREE 74
            :|.:||::|:||::..| |:::.::..||:||||..|||.|||||..:|:|||..|....:.||:
Zfish    10 SGTQMPLLGLGTYKLQDHEQLKQSVSCALQAGYRAFDTAAVYGNEAHLGQVLKELLPKYGLIRED 74

  Fly    75 LFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVT 139
            :||::|:.| |:.....:....:|||.|..:|:||||:|.|        |...||.|.....:. 
Zfish    75 VFIISKLAP-SDHGLRAKEGCLRSLEQLDCEYIDLYLIHWP--------GMEGLDPEDSRHSEY- 129

  Fly   140 TNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFCKS 204
              .|..|..:|.....|..|:|||||::...:..||.:|::.||..|||....|.||:|.|.|..
Zfish   130 --RAQSWATLEEFHASGQFKAIGVSNYTAKHIRELLASCRVPPAVLQIECQPKLIQRELRDLCME 192

  Fly   205 ENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAI 269
            ..|...|||.|| ||        .::|:       |||.:|....|:|||||||||.:..|:|.:
Zfish   193 TGIHFQAYSSLG-KG--------ALLRE-------PEVMDIVRHCGRTPAQVLLRWALQQGISVL 241

  Fly   270 PKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRIC--DFA 310
            |:|:.|:|:.:|..||||:|...::.:|..|:...|.|  ||:
Zfish   242 PRSSQPSRVLENAQVFDFKLNETDMKRLDDLNCGTRFCKRDFS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 110/291 (38%)
Tas 10..297 CDD:223739 108/286 (38%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 111/297 (37%)
Tas 17..271 CDD:223739 106/281 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.