DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and RGD1564865

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:327 Identity:120/327 - (36%)
Similarity:195/327 - (59%) Gaps:23/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTWQASD---EEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            ::|..||::|.||:|..:   .:|..:...|::.|:||||:|.||.|||.:|..::..:..|.||
  Rat    11 SDGRLMPLLGYGTFQNPEIPASKILESTKIAIDIGFRHIDSAYVYKNEKEVGEAIRSKITGGVVK 75

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG--LM 134
            ||::|:.||:....:||..|...:::||:..|||||||||:|.|.:|..:|: .:..|:.|  |.
  Rat    76 REDIFLTTKLWSTFHRPELVRVGLERSLKSFQLDYVDLYLIHYPISIKPSEE-IYTKDENGKILF 139

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRD 197
            |   |.:..|||.|||...:.||.||||||||::.|:..:|.  ..|.||..||:|.|.||.|..
  Rat   140 E---TVDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQSK 201

  Fly   198 LVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262
            |:|||||::|.:.||:.|||:....:     :.::.|.|::.|.:..:|..|.::|||:.||:.:
  Rat   202 LMDFCKSQDIVLVAYAALGSQRPTNW-----VDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQV 261

  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFF--HGVERHPEFTFKN 325
            ..||.|:.::.....:|:|:.||:|:|.:|::..|..|::|     |.:|  :....||.:.:.:
  Rat   262 QRGVVALAQTYEQKEMKENIQVFEFQLPSEDMEVLDGLNRN-----FRYFPVNIAAEHPNYPYSD 321

  Fly   326 QY 327
            .|
  Rat   322 DY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 114/298 (38%)
Tas 10..297 CDD:223739 112/293 (38%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 117/313 (37%)
Tas 19..297 CDD:223739 109/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.