DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and akr1b1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001011130.1 Gene:akr1b1 / 496546 XenbaseID:XB-GENE-5821742 Length:318 Species:Xenopus tropicalis


Alignment Length:320 Identity:130/320 - (40%)
Similarity:196/320 - (61%) Gaps:17/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELF 76
            |.:||::|:|||::...::..|:..|:|.||||:|.|.||.||..:|..:::.:..|.||||:||
 Frog    12 GAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEGLVKREDLF 76

  Fly    77 IVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTN 141
            :|:|:....:....|:...:|:|.||:|||:||||||.|...... |..|.||.||.: :...|:
 Frog    77 VVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQAG-DALFPLDNEGCV-IHSNTH 139

  Fly   142 HAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKS 204
            ....|..||.||:.||.|:||:|||:::|:.:||.  ..|.:||.:|.|.|.||.|:.|:|.|:|
 Frog   140 FLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHPYLTQKKLIDLCQS 204

  Fly   205 ENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVS 267
            :.|.|||||||||  :..||        .:.|.|::.|::||||..:.||.||||:|:.|...|.
 Frog   205 KGIVVTAYSPLGSPDRPWAK--------PEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHIQRNVV 261

  Fly   268 AIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            .||||..|||:::|..||||||:.|:...:.|.::..|:|..:   ..::|.::.|...|
 Frog   262 VIPKSVTPARIEENFQVFDFELSPEDTEAIFSFERGWRVCALS---SAKKHKDYPFHAAY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 125/293 (43%)
Tas 10..297 CDD:223739 124/288 (43%)
akr1b1NP_001011130.1 AKR_AKR1B1-19 12..318 CDD:381333 129/318 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.