DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR1B15

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:304 Identity:128/304 - (42%)
Similarity:183/304 - (60%) Gaps:19/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFIVTKV-PPVSNRPHEVE 92
            :::.|:..|::|.|||||.|..|.|:..:|..::..:....|.||:||||:|| |....|| .|.
Human    55 KVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFERP-LVR 118

  Fly    93 PTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGL 157
            ...:|:|:||:|.|:|:||:|.|......:|...|.||..::....|...|  |.|||.||::||
Human   119 KAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLDA--WEAMEELVDEGL 181

  Fly   158 TKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGS--K 218
            .|::|||||:..|:.|||.  ..|.:|..||:|.|.||.|..|:.:|.|:.|||||||||||  :
Human   182 VKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDR 246

  Fly   219 GIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLD 283
            ..||        .:.|.|::.|::|||||.|.||.||||:|:.|...|:.||||..||.:.:|:.
Human   247 PWAK--------PEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQ 303

  Fly   284 VFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            ||||:|:.||:|.:.|.::|.|..||..|..:|   :|.|..:|
Human   304 VFDFKLSDEEMATILSFNRNWRAFDFKEFSHLE---DFPFDAEY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 119/277 (43%)
Tas 10..297 CDD:223739 118/272 (43%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 120/279 (43%)
Tas 57..317 CDD:223739 118/270 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.