DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c19

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001013807.2 Gene:Akr1c19 / 432720 MGIID:2653678 Length:323 Species:Mus musculus


Alignment Length:325 Identity:127/325 - (39%)
Similarity:196/325 - (60%) Gaps:19/325 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTWQASDEEIE-----TAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK 69
            |:|..:|.:|.||::  .||:.     .||..|||||:||||||.||..|..:|:.::..:.||.
Mouse    11 NDGNFIPALGFGTYK--PEEVNENKPLEAIHLALEAGFRHIDTAYVYQTENHVGQAIRSKIAAGL 73

  Fly    70 VKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLM 134
            ||||::|:.||:....:||..|...::|||::|||||.||||:|.|..:...|| .|..|:.|..
Mouse    74 VKREDIFLTTKLWCTFHRPELVRSNLEKSLKNLQLDYADLYLIHYPVQMKPGED-LFPEDEHGKT 137

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRD 197
            ..| |.:..|.|.|||...:.||.||||||||:..|:.::|.  ..|.:|..||:|.|:||.||.
Mouse   138 LFD-TVDICATWEAMEKCKDAGLVKSIGVSNFNSRQLEKILNKPGLKYKPVCNQVECHLYLNQRK 201

  Fly   198 LVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262
            |:::|||::|.:.||..|||:...::     :....|.|::.|.:.::|..|.::|||:.||:.:
Mouse   202 LLNYCKSKDIVLVAYCALGSQRPKRW-----VDPSSPVLLNDPILCDMAKKHKRSPAQIALRYHL 261

  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            ..|:..:.:|.....:|:|:.||:|||.:|::..|.|||:|:|.....|..|   |||:.|.:::
Mouse   262 QRGIVVLAQSYKENEIKENIQVFEFELPSEDMKILDSLDRNLRYAPAPFGEG---HPEYPFSDEF 323

  Fly   328  327
            Mouse   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 118/298 (40%)
Tas 10..297 CDD:223739 115/293 (39%)
Akr1c19NP_001013807.2 ARA1 8..307 CDD:223729 121/304 (40%)
Tas 11..310 CDD:223739 121/307 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.