DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and CG10863

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster


Alignment Length:302 Identity:121/302 - (40%)
Similarity:182/302 - (60%) Gaps:11/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            ::..|||.::..||:||:.:...:.|.|...|::.||||||||..|.||..:|..::|.:..|.:
  Fly     7 YVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVI 71

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGS-FKLDKEGLM 134
            |||::.|.||:....:.|..||...:|:|::..|.||||||:|.|::.....|.. ...|.:|.:
  Fly    72 KREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEV 136

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199
            |:: ..::...|..||.|||.|||||||||||:.:|:.|||.||||:|.:||||.|..|.|:.|:
  Fly   137 ELN-DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLI 200

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            ..||..:|.||||.|||....|:         ..|:.:...:|:.|...:.|:.|||:||::|:.
  Fly   201 ALCKKNDIVVTAYCPLGRPNPAE---------KTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEI 256

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRI 306
            |...:|||:||.|:::|..:|||:|.||:.|.|.|.:...|:
  Fly   257 GTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGERL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 120/296 (41%)
Tas 10..297 CDD:223739 118/287 (41%)
CG10863NP_647840.1 ARA1 6..304 CDD:223729 121/302 (40%)
Tas 11..290 CDD:223739 118/288 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
87.920

Return to query results.
Submit another query.