DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c12

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:323 Identity:118/323 - (36%)
Similarity:193/323 - (59%) Gaps:15/323 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            |:|..:|.:|.||::..:.....:::|   |::.||||||||..|..|:.||:.::..:.||.||
  Rat    11 NDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEEIGQAIQSKIKAGVVK 75

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136
            |:::||.||:.....|...|.|.::|||::||||||||:|:|.|..|..:.|.| .||::|...:
  Rat    76 RKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDES-PLDEKGKFLL 139

  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199
            | |.:....|..:|...:.||.||||||||:..|:.|||.  ..|.:|..||:|.|:||.|..|:
  Rat   140 D-TVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLL 203

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            |:|||::|.:.||..||::...::     :.::.|.|:|.|.:.::|..:.::||.:.||::...
  Rat   204 DYCKSKDIVLVAYGALGTQRYKEW-----VDQNSPVLLDDPILCDVAKKNKRSPALIALRYLFQR 263

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            ||..:.:|.....:::||.||:|:|:.|::..|..|::|.|.....|   :..|||:.|..:|
  Rat   264 GVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEF---LADHPEYPFSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 110/296 (37%)
Tas 10..297 CDD:223739 108/291 (37%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 111/300 (37%)
Tas 16..297 CDD:223739 106/287 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H105824
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.